www.bluecoutureclub.com - Elite London escortas and high class International escorts are accessible through our exclusive VIP - Bluecoutureclub

bluecoutureclub.com

visit the website

Bluecoutureclub is #2,556,067 website in United Kingdom. "Elite London escortas and high class International escorts are accessible through our exclusive VIP ."

2,556,067

26,257,935

World Rank

Domain http://www.bluecoutureclub.com
Daily visits 13
Daily pages views 35
Estimated value £277 *
Income per visitor £2.30
Incoming links 36
Keyphrases
-
Rank in Countries
g+ twitter facebook

Web Traffic

Statistics History 3 Months Average
World Rank 26,257,935 +1,347,032
Monthly Visitors 360 -5.13%
Monthly Visitors Rank 59,803,011 +3,067,894
Monthly Pageviews 1,050 -5.8%
Monthly Pageviews Rank 59,803,011 +3,468,575
Pageviews Per Visitor 2.98 -

Context

Headlines for www.bluecoutureclub.com
The domain has been registered 8 years 5 months 5 days ago.

Related Websites

connexionweb.co.uk   orientalmassagelondon.co.uk   007escorts.co.uk   absolutelondonescorts.co.uk   agencybarracuda.co.uk   awakeningtantricenergyspamassage.com   blog4asianescorts.co.uk   blog4escorts.co.uk   candylipsescorts.co.uk   

Web Server

Data Center Information

AS62240 Clouvider Limited
London
England
United Kingdom
51.5085, -0.1257
Web server load time is 0.88 seconds.
Its nameservers are ns1.lucid.dnsonly.co.uk (185.42.221.40), ns2.lucid.dnsonly.co.uk (185.42.221.41). Its IP number is 185.42.221.40
IP: 185.42.221.40
Server type: Apache
Charset: UTF-8
PING www.bluecoutureclub.com (185.42.221.40) The package size is 44 bytes.
44 bytes for 185.42.221.40: seq_num=1 TTL=77 40.2 ms
44 bytes for 185.42.221.40: seq_num=2 TTL=77 38.8 ms
44 bytes for 185.42.221.40: seq_num=3 TTL=77 39.9 ms
--- www.bluecoutureclub.com ping results ---
4 queries proceeded, 4 packets received, 0 lost (0% loss)
An average ping to the server is 29.7 ms, and the page load time is 0.88 seconds.
Web Server Configuration
Cache Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Content Length: 0
Content Type: text/html; charset=UTF-8
Date: Sun, 26 Mar 2017 15:11:42 GMT
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Link: ; rel=shortlink
Pragma: no-cache
Web Server: Apache
X Powered By: PHP/5.3.29
Cookies: +
P3P: -
Vary: -
ETag: -
MD5 Content: -
Public Key Pins: -

The data is estimated*
Data modified: 28.09.2017 20:54:24