buxtonandhighpeakgolfclub.co.uk
visit the websiteBuxtonandhighpeakgolfclub is #1,232,710 website in United Kingdom. "Buxton And High Peak Golf Club: Premier Golf Club In Buxton – England."
Advertisements
1,232,710
18,883,423
World Rank
Domain | http://www.buxtonandhighpeakgolfclub.co.uk |
Daily visits | 20 |
Daily pages views | 78 |
Estimated value | £371 * |
Income per visitor | £2.48 |
Incoming links | 31 |
Keyphrases |
---|
- |
Rank in Countries |
---|
Web Traffic
Statistics History 3 Months Average | ||
---|---|---|
World Rank | 18,883,423 | -1,176,437 |
Monthly Visitors | 480 | 6.23% |
Monthly Visitors Rank | 90,223,917 | -5,620,950 |
Monthly Pageviews | 2,340 | -7.92% |
Monthly Pageviews Rank | 90,223,917 | +7,145,734 |
Pageviews Per Visitor | 4.88 | - |
Context
Headlines for www.buxtonandhighpeakgolfclub.co.uk | |
---|---|
Related Websites
buxtonaccommodation.co.uk buxtonaccounting.co.uk buxtonacupuncture.co.uk buxtonadventurefestival.co.uk buxtonadvertiser.co.uk buxtonandbonnet.com buxtonandgrantpharmacy.co.uk buxtonandhighpeaklocksmith.co.uk buxtonandmacclesfieldchimneysweep.co.ukWeb Server
Data Center Information | |
---|---|
Linode AS8001 Net Access Corporation Newark New Jersey United States 40.7357, -74.1724 |
|
Web server load time is 1.16 seconds. |
Its nameservers are nsb.nic.uk (156.154.101.3), dns1.nic.uk (213.248.216.1), dns3.nic.uk (213.248.220.1), nsd.nic.uk (156.154.103.3), nsa.nic.uk (156.154.100.3), dns2.nic.uk (103.49.80.1), dns4.nic.uk (43.230.48.1), nsc.nic.uk (156.154.102.3). Its IP number is 66.228.41.61 | |
IP: | 66.228.41.61 |
Server type: | Apache |
Charset: | UTF-8 |
PING www.buxtonandhighpeakgolfclub.co.uk (66.228.41.61) The package size is 49 bytes. | |
---|---|
49 bytes for 66.228.41.61: seq_num=1 TTL=65 | 33.1 ms |
49 bytes for 66.228.41.61: seq_num=2 TTL=65 | 32.9 ms |
49 bytes for 66.228.41.61: seq_num=3 TTL=65 | 32.9 ms |
--- www.buxtonandhighpeakgolfclub.co.uk ping results --- | |
4 queries proceeded, 4 packets received, 0 lost (0% loss) | |
An average ping to the server is 24.7 ms, and the page load time is 1.16 seconds. |
Web Server Configuration | |
---|---|
Content Length: | 0 |
Content Type: | text/html; charset=UTF-8 |
Date: | Sun, 26 Mar 2017 12:23:07 GMT |
Link: | ; rel="https://api.w.org/", ; rel=shortlink |
Web Server: | Apache |
X Powered By: | PHP/5.4.45 |
P3P: | - |
Cookies: | - |
Vary: | - |
ETag: | - |
MD5 Content: | - |
Public Key Pins: | - |
The data is estimated*
Data modified: 08.06.2017 23:57:38
Advertisements