harpendenblockpavingpavecraft.co.uk
visit the websiteHarpendenblockpavingpavecraft is #2,783,612 website in United Kingdom. "Block Paving and Driveway Paving in Harpenden by Pavecraft Ltd."
Advertisements
2,783,612
27,557,611
World Rank
| Domain | http://www.harpendenblockpavingpavecraft.co.uk |
| Daily visits | 13 |
| Daily pages views | 47 |
| Estimated value | £303 * |
| Income per visitor | £2.42 |
| Incoming links | 0 |
| Keyphrases |
|---|
| - |
| Rank in Countries |
|---|
Web Traffic
| Statistics History 3 Months Average | ||
|---|---|---|
| World Rank | 27,557,611 | -1,909,742
 |
| Monthly Visitors | 330 | 6.93%
|
| Monthly Visitors Rank | 23,729,878 | -1,644,481
|
| Monthly Pageviews | 1,410 | -8.84%
 |
| Monthly Pageviews Rank | 23,729,878 |
+2,097,721
|
| Pageviews Per Visitor | 4.32 | - |
Context
| Headlines for www.harpendenblockpavingpavecraft.co.uk | |
|---|---|
Related Websites
harpenden-arms.co.uk harpenden-bookkeepers.com harpenden-bookkeeping.com harpenden-bs.co.uk pavecraft.co.uk drivewaypavinghemelhempstead.co.uk drivewaypavingnorthwood.co.uk drivewaypavingstalbans.co.uk drivewaypavingwatford.co.ukLinks
| Outgoing Links | |
|---|---|
| pavecraft.co.uk | |
| 330 guests visit the website monthly, each of them views about 4.32 pages. | |
Web Server
| Data Center Information | |
|---|---|
|
Webfusion Internet Solutions AS20738 Webfusion Internet Solutions Derby England United Kingdom 52.9228, -1.4766 |
|
| Web server load time is 0.19 seconds. | |
| Its nameservers are nsb.nic.uk (156.154.101.3), nsa.nic.uk (156.154.100.3), nsd.nic.uk (156.154.103.3), dns3.nic.uk (213.248.220.1), nsc.nic.uk (156.154.102.3), dns2.nic.uk (103.49.80.1), dns4.nic.uk (43.230.48.1), dns1.nic.uk (213.248.216.1). Its IP number is 46.32.242.175 | |
| IP: | 46.32.242.175 |
| Server type: | Apache/2.4.18 (Unix) |
| Charset: | UTF-8 |
| PING www.harpendenblockpavingpavecraft.co.uk (46.32.242.175) The package size is 52 bytes. | |
|---|---|
| 52 bytes for 46.32.242.175: seq_num=1 TTL=56 | 61.7 ms |
| 52 bytes for 46.32.242.175: seq_num=2 TTL=56 | 60.9 ms |
| 52 bytes for 46.32.242.175: seq_num=3 TTL=56 | 61.7 ms |
| --- www.harpendenblockpavingpavecraft.co.uk ping results --- | |
| 4 queries proceeded, 4 packets received, 0 lost (0% loss) | |
| An average ping to the server is 46.1 ms, and the page load time is 0.19 seconds. | |
| Web Server Configuration | |
|---|---|
| Accept Ranges: | bytes |
| Content Length: | 3189 |
| Content Type: | text/html |
| Date: | Tue, 28 Mar 2017 20:07:02 GMT |
| Last Modified: | Fri, 02 Oct 2015 18:38:39 GMT |
| Web Server: | Apache/2.4.18 (Unix) |
| ETag: | + |
| P3P: | - |
| Cookies: | - |
| Vary: | - |
| MD5 Content: | - |
| Public Key Pins: | - |
The data is estimated*
Data modified: 09.06.2017 00:07:59
Advertisements