hazeleyes.co.uk
visit the websiteHazeleyes is #397,191 website in United Kingdom. "Mature Busty Escort in Birmingham Hazeleyes ."
397,191
12,586,905
World Rank
| Domain | http://www.hazeleyes.co.uk |
| Daily visits | 27 |
| Daily pages views | 137 |
| Estimated value | £501 * |
| Income per visitor | £2.27 |
| Incoming links | 8 |
| Keyphrases |
|---|
| - |
| Rank in Countries |
|---|
Web Traffic
| Statistics History 3 Months Average | ||
|---|---|---|
| World Rank | 12,586,905 | -872,273
 |
| Monthly Visitors | 720 | 6.93%
|
| Monthly Visitors Rank | 76,236,802 | -5,283,210
|
| Monthly Pageviews | 4,110 | -0.76%
 |
| Monthly Pageviews Rank | 76,236,802 |
+579,400
|
| Pageviews Per Visitor | 5.72 | - |
Context
| Headlines for www.hazeleyes.co.uk | |
|---|---|
Related Websites
connexionweb.co.uk orientalmassagelondon.co.uk 007escorts.co.uk absolutelondonescorts.co.uk agencybarracuda.co.uk awakeningtantricenergyspamassage.com blog4asianescorts.co.uk blog4escorts.co.uk bluecoutureclub.comLinks
| Outgoing Links | |
|---|---|
| live.co.uk | |
| hazeleyesescort.co.uk | |
| hazeleyesescort.co.uk | |
| hazeleyesescort.co.uk | |
| hazeleyesescort.co.uk | |
| 720 guests visit the website monthly, each of them views about 5.72 pages. | |
Web Server
| Data Center Information | |
|---|---|
|
AS62240 Clouvider Limited London England United Kingdom 51.5085, -0.1257 |
|
| Web server load time is 0.53 seconds. | |
| Its nameservers are nsb.nic.uk (156.154.101.3), nsa.nic.uk (156.154.100.3), nsd.nic.uk (156.154.103.3), dns3.nic.uk (213.248.220.1), nsc.nic.uk (156.154.102.3), dns2.nic.uk (103.49.80.1), dns4.nic.uk (43.230.48.1), dns1.nic.uk (213.248.216.1). Its IP number is 185.42.221.40 | |
| IP: | 185.42.221.40 |
| Server type: | Apache |
| Charset: | UTF-8 |
| PING www.hazeleyes.co.uk (185.42.221.40) The package size is 47 bytes. | |
|---|---|
| 47 bytes for 185.42.221.40: seq_num=1 TTL=59 | 23.2 ms |
| 47 bytes for 185.42.221.40: seq_num=2 TTL=59 | 22.3 ms |
| 47 bytes for 185.42.221.40: seq_num=3 TTL=59 | 23.7 ms |
| --- www.hazeleyes.co.uk ping results --- | |
| 4 queries proceeded, 4 packets received, 0 lost (0% loss) | |
| An average ping to the server is 17.3 ms, and the page load time is 0.53 seconds. | |
| Web Server Configuration | |
|---|---|
| Content Type: | text/html; charset=UTF-8 |
| Date: | Tue, 28 Mar 2017 22:39:56 GMT |
| Link: | ; rel="https://api.w.org/", ; rel=shortlink |
| Web Server: | Apache |
| P3P: | - |
| Cookies: | - |
| Vary: | - |
| ETag: | - |
| MD5 Content: | - |
| Public Key Pins: | - |
The data is estimated*
Data modified: 28.09.2017 20:54:24