kalleuk.co.uk
Kalleuk is #1,072,982 website in United Kingdom. "Kalle UK - Sausage Casings and Packaging for the Food Industry - Sausage Casings. Cellulose Casings."
Advertisements
1,072,982
25,936,739
World Rank
| Domain | kalleuk.co.uk |
| Daily visits | 14 |
| Daily pages views | 81 |
| Estimated value | £378 * |
| Income per visitor | £2.43 |
| Incoming links | 0 |
| Keyphrases |
|---|
| sausage casings, sausage casing, food casings, food, sausage, casings, kalle, nalo, kalle nalo, packaging |
| Rank in Countries |
|---|
Web Traffic
| Statistics History 3 Months Average | ||
|---|---|---|
| World Rank | 25,936,739 | -1,662,545
 |
| Monthly Visitors | 360 | 6.41%
|
| Monthly Visitors Rank | 25,799,102 | -1,653,722
|
| Monthly Pageviews | 2,430 | -1%
 |
| Monthly Pageviews Rank | 14,835,002 |
+148,350
|
| Pageviews Per Visitor | 6.76 | - |
Context
| Headlines for www.kalleuk.co.uk | |
|---|---|
Related Websites
ehhs.org.uk enviroeng.co.uk grovesyart.co.uk tigerlilyagency.co.uk alternative-heating.uk ianashdown.co.uk keytalent.co.uk pilgrimswaycaravanandcamping.co.uk tigerlilyeducation.co.ukWeb Server
| Data Center Information | |
|---|---|
|
1&1 Internet AG AS8560 1&1 Internet AG Karlsruhe Baden-Wurttemberg Germany 49.0047, 8.3858 |
|
| Web server load time is 0.42 seconds. | |
| Its nameservers are ns1.nic.uk (195.66.240.130), ns2.nic.uk (217.79.164.131), nsd.nic.uk (156.154.103.3), ns4.nic.uk (194.83.244.131), ns5.nic.uk (213.246.167.131), ns6.nic.uk (213.248.254.130), ns7.nic.uk (212.121.40.130), nsa.nic.uk (156.154.100.3), nsb.nic.uk (156.154.101. Its IP number is 217.160.46.162 | |
| IP: | 217.160.46.162 |
| Server type: | Microsoft-IIS/7.5 |
| Charset: | ISO-8859-1 |
| PING www.kalleuk.co.uk (217.160.46.162) The package size is 53 bytes. | |
|---|---|
| 53 bytes for 217.160.46.162: seq_num=1 TTL=72 | 23.4 ms |
| 53 bytes for 217.160.46.162: seq_num=2 TTL=72 | 23.3 ms |
| 53 bytes for 217.160.46.162: seq_num=3 TTL=72 | 24.1 ms |
| --- www.kalleuk.co.uk ping results --- | |
| 4 queries proceeded, 4 packets received, 0 lost (0% loss) | |
| An average ping to the server is 17.7 ms, and the page load time is 0.42 seconds. | |
| Web Server Configuration | |
|---|---|
| Cache Control: | private |
| Content Length: | 6479 |
| Content Type: | text/html |
| Date: | Sun, 22 Feb 2015 17:53:30 GMT |
| Web Server: | Microsoft-IIS/7.5 |
| X Powered By: | ASP.NET |
| Cookies: | + |
| P3P: | - |
| Vary: | - |
| ETag: | - |
| MD5 Content: | - |
| Public Key Pins: | - |
The data is estimated*
Data modified: 23.03.2017 20:40:21
Advertisements