ramkrishnavivekanandamission.com
visit the websiteRamkrishnavivekanandamission is #3,109,086 website in United Kingdom. "Index of /."
Advertisements
3,109,086
29,440,810
World Rank
| Domain | http://www.ramkrishnavivekanandamission.com |
| Daily visits | 12 |
| Daily pages views | 32 |
| Estimated value | £270 * |
| Income per visitor | £2.27 |
| Incoming links | 0 |
| Keyphrases |
|---|
| - |
| Rank in Countries |
|---|
Web Traffic
| Statistics History 3 Months Average | ||
|---|---|---|
| World Rank | 29,440,810 | -806,678
 |
| Monthly Visitors | 300 | 2.74%
|
| Monthly Visitors Rank | 30,879,006 | -846,085
|
| Monthly Pageviews | 960 | 3.52%
|
| Monthly Pageviews Rank | 30,879,006 |
-1,086,941
|
| Pageviews Per Visitor | 3.28 | - |
Context
| Headlines for www.ramkrishnavivekanandamission.com | |
|---|---|
| The domain has been registered 7 years 8 months 5 days ago. | |
Related Websites
ramkrishnani.com ramkrishnasaraswatividyaniketan.com dialforads.com loadstarcreation.com monotoshroy.com positivenewsworld.com shacademia.com softechitsolution.com tsfprojects.comWeb Server
| Data Center Information | |
|---|---|
|
DreamScape Networks FZ-LLC AS38719 Aust Domains International Pty Ltd. London England United Kingdom 51.5085, -0.1257 |
|
| Web server load time is 0.16 seconds. | |
| Its nameservers are ns1.syrahost.com (27.124.125.1), ns2.syrahost.com (27.124.125.2). Its IP number is 176.74.27.89 | |
| IP: | 176.74.27.89 |
| Server type: | nginx |
| Charset: | UTF-8 |
| PING www.ramkrishnavivekanandamission.com (176.74.27.89) The package size is 46 bytes. | |
|---|---|
| 46 bytes for 176.74.27.89: seq_num=1 TTL=60 | 24.2 ms |
| 46 bytes for 176.74.27.89: seq_num=2 TTL=60 | 24.9 ms |
| 46 bytes for 176.74.27.89: seq_num=3 TTL=60 | 24.4 ms |
| --- www.ramkrishnavivekanandamission.com ping results --- | |
| 4 queries proceeded, 4 packets received, 0 lost (0% loss) | |
| An average ping to the server is 18.4 ms, and the page load time is 0.16 seconds. | |
| Web Server Configuration | |
|---|---|
| Content Length: | 447 |
| Content Type: | text/html;charset=ISO-8859-1 |
| Date: | Fri, 31 Mar 2017 15:26:40 GMT |
| Web Server: | nginx |
| Vary: | + |
| P3P: | - |
| Cookies: | - |
| ETag: | - |
| MD5 Content: | - |
| Public Key Pins: | - |
The data is estimated*
Data modified: 09.06.2017 00:21:16
Advertisements