washingmachinerepairkingslynn.co.uk
Washingmachinerepairkingslynn is #1,662,412 website in United Kingdom. "Washing Machine Repair Kings Lynn are your reliable, local specialists in washing machine and washe."
Advertisements
1,662,412
33,570,787
World Rank
| Domain | washingmachinerepairkingslynn.co.uk |
| Daily visits | 10 |
| Daily pages views | 40 |
| Estimated value | £288 * |
| Income per visitor | £2.13 |
| Incoming links | 8 |
| Keyphrases |
|---|
| washing machine repair, washing machiner repairs, washing machines, kings lynn |
| Rank in Countries |
|---|
Web Traffic
| Statistics History 3 Months Average | ||
|---|---|---|
| World Rank | 33,570,787 | +3,263,080
 |
| Monthly Visitors | 270 | -9.72%
|
| Monthly Visitors Rank | 36,987,523 | +3,595,187
|
| Monthly Pageviews | 1,200 | 8.14%
 |
| Monthly Pageviews Rank | 39,525,407 |
-3,217,368
|
| Pageviews Per Visitor | 4.48 | - |
Context
| Headlines for www.washingmachinerepairkingslynn.co.uk | |
|---|---|
Related Websites
washing-instructions.com washing-machine-rental-blackpool.co.uk washing-machine-repair-london.org.uk washing-machine-repair.co.uk washing-machine-repairs-blackpool.co.uk washing-machine-repairs-london.co.uk washing-machine-reviews.org.uk washing-machines.com washing-machines.me.ukWeb Server
| Data Center Information | |
|---|---|
|
- - - 0, 0 |
|
| Web server load time is 0.17 seconds. | |
| Its nameservers are ns1.nic.uk (195.66.240.130), nsd.nic.uk (156.154.103.3), ns2.nic.uk (217.79.164.131), ns6.nic.uk (213.248.254.130), nsc.nic.uk (156.154.102.3), ns7.nic.uk (212.121.40.130), ns5.nic.uk (213.246.167.131), nsb.nic.uk (156.154.101.3), nsa.nic.uk (156.154.100.. Its IP number is 0.0.0.0 | |
| IP: | 0.0.0.0 |
| Server type: | Apache |
| Charset: | ISO-8859-1 |
| PING www.washingmachinerepairkingslynn.co.uk (0.0.0.0) The package size is 30 bytes. | |
|---|---|
| 30 bytes for 0.0.0.0: seq_num=1 TTL=78 | 41.2 ms |
| 30 bytes for 0.0.0.0: seq_num=2 TTL=78 | 40.2 ms |
| 30 bytes for 0.0.0.0: seq_num=3 TTL=78 | 40.4 ms |
| --- www.washingmachinerepairkingslynn.co.uk ping results --- | |
| 4 queries proceeded, 4 packets received, 0 lost (0% loss) | |
| An average ping to the server is 30.5 ms, and the page load time is 0.17 seconds. | |
| Web Server Configuration | |
|---|---|
| Content Length: | 255 |
| Content Type: | text/html; charset=iso-8859-1 |
| Date: | Sun, 22 Mar 2015 08:57:45 GMT |
| Web Server: | Apache |
| X Powered By: | PHP/5.2.14 |
| P3P: | - |
| Cookies: | - |
| Vary: | - |
| ETag: | - |
| MD5 Content: | - |
| Public Key Pins: | - |
The data is estimated*
Data modified: 24.03.2017 22:50:33
Advertisements