dreamyescorts.agency
visit the websiteDreamyescorts is #1,288,351 website in United Kingdom. "Dreamy Escorts |."
1,288,351
19,180,464
World Rank
| Domain | http://www.dreamyescorts.agency |
| Daily visits | 18 |
| Daily pages views | 84 |
| Estimated value | £385 * |
| Income per visitor | £2.29 |
| Incoming links | 0 |
| Keyphrases |
|---|
| - |
| Rank in Countries |
|---|
Web Traffic
| Statistics History 3 Months Average | ||
|---|---|---|
| World Rank | 19,180,464 | +1,060,680
 |
| Monthly Visitors | 480 | -5.53%
|
| Monthly Visitors Rank | 30,562,462 | +1,690,104
|
| Monthly Pageviews | 2,520 | -5%
|
| Monthly Pageviews Rank | 30,562,462 |
+1,528,123
|
| Pageviews Per Visitor | 5.27 | - |
Context
| Headlines for www.dreamyescorts.agency | |
|---|---|
Related Websites
connexionweb.co.uk orientalmassagelondon.co.uk 007escorts.co.uk absolutelondonescorts.co.uk agencybarracuda.co.uk awakeningtantricenergyspamassage.com blog4asianescorts.co.uk blog4escorts.co.uk bluecoutureclub.comWeb Server
| Data Center Information | |
|---|---|
|
AS62240 Clouvider Limited London England United Kingdom 51.5085, -0.1257 |
|
| Web server load time is 0.29 seconds. | |
| Its nameservers are ns2.123-reg.co.uk (92.51.159.40), ns1.lucid.dnsonly.co.uk (185.42.221.40). Its IP number is 185.42.221.40 | |
| IP: | 185.42.221.40 |
| Server type: | Apache |
| Charset: | UTF-8 |
| PING www.dreamyescorts.agency (185.42.221.40) The package size is 36 bytes. | |
|---|---|
| 36 bytes for 185.42.221.40: seq_num=1 TTL=57 | 26.5 ms |
| 36 bytes for 185.42.221.40: seq_num=2 TTL=57 | 27.5 ms |
| 36 bytes for 185.42.221.40: seq_num=3 TTL=57 | 26.5 ms |
| --- www.dreamyescorts.agency ping results --- | |
| 4 queries proceeded, 4 packets received, 0 lost (0% loss) | |
| An average ping to the server is 20.1 ms, and the page load time is 0.29 seconds. | |
| Web Server Configuration | |
|---|---|
| Cache Control: | no-store, no-cache, must-revalidate, post-check=0, pre-check=0 |
| Content Type: | text/html; charset=UTF-8 |
| Date: | Mon, 27 Mar 2017 04:57:38 GMT |
| Expires: | Thu, 19 Nov 1981 08:52:00 GMT |
| Link: | ; rel=shortlink |
| Pragma: | no-cache |
| Web Server: | Apache |
| Cookies: | + |
| Vary: | + |
| P3P: | - |
| ETag: | - |
| MD5 Content: | - |
| Public Key Pins: | - |
The data is estimated*
Data modified: 28.09.2017 20:54:24