dreamyescorts.london
visit the websiteDreamyescorts is #2,559,691 website in United Kingdom. "Dreamy Escorts |."
2,559,691
26,278,187
World Rank
| Domain | http://www.dreamyescorts.london |
| Daily visits | 15 |
| Daily pages views | 45 |
| Estimated value | £299 * |
| Income per visitor | £2.60 |
| Incoming links | 0 |
| Keyphrases |
|---|
| - |
| Rank in Countries |
|---|
Web Traffic
| Statistics History 3 Months Average | ||
|---|---|---|
| World Rank | 26,278,187 | -1,715,966
 |
| Monthly Visitors | 360 | 6.53%
|
| Monthly Visitors Rank | 21,075,192 | -1,376,210
|
| Monthly Pageviews | 1,350 | -6%
 |
| Monthly Pageviews Rank | 21,075,192 |
+1,264,512
|
| Pageviews Per Visitor | 3.77 | - |
Context
| Headlines for www.dreamyescorts.london | |
|---|---|
Related Websites
connexionweb.co.uk orientalmassagelondon.co.uk 007escorts.co.uk absolutelondonescorts.co.uk agencybarracuda.co.uk awakeningtantricenergyspamassage.com blog4asianescorts.co.uk blog4escorts.co.uk bluecoutureclub.comWeb Server
| Data Center Information | |
|---|---|
|
AS62240 Clouvider Limited London England United Kingdom 51.5085, -0.1257 |
|
| Web server load time is 0.29 seconds. | |
| Its nameservers are ns1.lucid.dnsonly.co.uk (185.42.221.40), ns2.lucid.dnsonly.co.uk (185.42.221.41). Its IP number is 185.42.221.40 | |
| IP: | 185.42.221.40 |
| Server type: | Apache |
| Charset: | UTF-8 |
| PING www.dreamyescorts.london (185.42.221.40) The package size is 46 bytes. | |
|---|---|
| 46 bytes for 185.42.221.40: seq_num=1 TTL=69 | 24.3 ms |
| 46 bytes for 185.42.221.40: seq_num=2 TTL=69 | 24.0 ms |
| 46 bytes for 185.42.221.40: seq_num=3 TTL=69 | 23.2 ms |
| --- www.dreamyescorts.london ping results --- | |
| 4 queries proceeded, 4 packets received, 0 lost (0% loss) | |
| An average ping to the server is 17.9 ms, and the page load time is 0.29 seconds. | |
| Web Server Configuration | |
|---|---|
| Cache Control: | max-age=3, must-revalidate |
| Content Type: | text/html; charset=UTF-8 |
| Date: | Mon, 27 Mar 2017 04:57:41 GMT |
| Web Server: | Apache |
| Vary: | + |
| P3P: | - |
| Cookies: | - |
| ETag: | - |
| MD5 Content: | - |
| Public Key Pins: | - |
The data is estimated*
Data modified: 28.09.2017 20:54:24