eastangliaescortsblog.co.uk
visit the websiteEastangliaescortsblog is #1,496,760 website in United Kingdom. "Escorts in Norfolk, Suffolk, Essex and Cambridgshire."
1,496,760
20,329,150
World Rank
| Domain | http://www.eastangliaescortsblog.co.uk |
| Daily visits | 17 |
| Daily pages views | 60 |
| Estimated value | £332 * |
| Income per visitor | £2.26 |
| Incoming links | 0 |
| Keyphrases |
|---|
| - |
| Rank in Countries |
|---|
Web Traffic
| Statistics History 3 Months Average | ||
|---|---|---|
| World Rank | 20,329,150 | -1,754,406
 |
| Monthly Visitors | 450 | 8.63%
|
| Monthly Visitors Rank | 28,203,130 | -2,433,930
|
| Monthly Pageviews | 1,800 | -2.24%
 |
| Monthly Pageviews Rank | 28,203,130 |
+631,750
|
| Pageviews Per Visitor | 4.02 | - |
Context
| Headlines for www.eastangliaescortsblog.co.uk | |
|---|---|
Related Websites
connexionweb.co.uk orientalmassagelondon.co.uk 007escorts.co.uk absolutelondonescorts.co.uk agencybarracuda.co.uk awakeningtantricenergyspamassage.com blog4asianescorts.co.uk blog4escorts.co.uk bluecoutureclub.comLinks
| Outgoing Links | |
|---|---|
| midnightdelights.co.uk | |
| midnighttreats.co.uk | |
| midnighttreats.co.uk | |
| midnighttreats.co.uk | |
| luxuryescort.co.uk | |
| exclusivelondonmodels.co.uk | |
| fantasylondongirls.co.uk | |
| fantasylondongirls.co.uk | |
| fantasylondongirls.co.uk | |
| fantasylondongirls.co.uk | |
| kensingtonbabes.co.uk | |
| kensingtonbabes.co.uk | |
| vipcompanioninternational.co.uk | |
| 450 guests visit the website monthly, each of them views about 4.02 pages. | |
Web Server
| Data Center Information | |
|---|---|
|
AS62240 Clouvider Limited London England United Kingdom 51.5085, -0.1257 |
|
| Web server load time is 0.51 seconds. | |
| Its nameservers are nsa.nic.uk (156.154.100.3), dns3.nic.uk (213.248.220.1), dns1.nic.uk (213.248.216.1), dns2.nic.uk (103.49.80.1), nsb.nic.uk (156.154.101.3), dns4.nic.uk (43.230.48.1), nsc.nic.uk (156.154.102.3), nsd.nic.uk (156.154.103.3). Its IP number is 185.42.221.40 | |
| IP: | 185.42.221.40 |
| Server type: | Apache |
| Charset: | UTF-8 |
| PING www.eastangliaescortsblog.co.uk (185.42.221.40) The package size is 28 bytes. | |
|---|---|
| 28 bytes for 185.42.221.40: seq_num=1 TTL=59 | 37.7 ms |
| 28 bytes for 185.42.221.40: seq_num=2 TTL=59 | 36.6 ms |
| 28 bytes for 185.42.221.40: seq_num=3 TTL=59 | 37.7 ms |
| --- www.eastangliaescortsblog.co.uk ping results --- | |
| 4 queries proceeded, 4 packets received, 0 lost (0% loss) | |
| An average ping to the server is 28 ms, and the page load time is 0.51 seconds. | |
| Web Server Configuration | |
|---|---|
| Cache Control: | no-store, no-cache, must-revalidate, post-check=0, pre-check=0 |
| Content Length: | 0 |
| Content Type: | text/html; charset=UTF-8 |
| Date: | Mon, 27 Mar 2017 09:13:16 GMT |
| Expires: | Thu, 19 Nov 1981 08:52:00 GMT |
| Link: | ; rel=shortlink |
| Pragma: | no-cache |
| Web Server: | Apache |
| Cookies: | + |
| P3P: | - |
| Vary: | - |
| ETag: | - |
| MD5 Content: | - |
| Public Key Pins: | - |
The data is estimated*
Data modified: 28.09.2017 20:54:24