exclusivelondonmodels.net
visit the websiteExclusivelondonmodels is #2,028,041 website in United Kingdom. "Exclusive London Models escorts is an agency promoting the high class escorts and VIP escorts in Lon."
2,028,041
23,304,219
World Rank
| Domain | http://www.exclusivelondonmodels.net |
| Daily visits | 17 |
| Daily pages views | 40 |
| Estimated value | £288 * |
| Income per visitor | £2.57 |
| Incoming links | 1 |
| Keyphrases |
|---|
| - |
| Rank in Countries |
|---|
Web Traffic
| Statistics History 3 Months Average | ||
|---|---|---|
| World Rank | 23,304,219 | -2,034,458
 |
| Monthly Visitors | 390 | 8.73%
|
| Monthly Visitors Rank | 24,859,545 | -2,170,238
|
| Monthly Pageviews | 1,200 | -8%
 |
| Monthly Pageviews Rank | 24,859,545 |
+1,988,764
|
| Pageviews Per Visitor | 3.12 | - |
Context
| Headlines for www.exclusivelondonmodels.net | |
|---|---|
| The domain has been registered 11 years 2 months 7 days ago. | |
Related Websites
connexionweb.co.uk orientalmassagelondon.co.uk 007escorts.co.uk absolutelondonescorts.co.uk agencybarracuda.co.uk awakeningtantricenergyspamassage.com blog4asianescorts.co.uk blog4escorts.co.uk bluecoutureclub.comWeb Server
| Data Center Information | |
|---|---|
|
AS62240 Clouvider Limited London England United Kingdom 51.5085, -0.1257 |
|
| Web server load time is 0.73 seconds. | |
| Its nameservers are ns1.lucid.dnsonly.co.uk (185.42.221.40), ns2.lucid.dnsonly.co.uk (185.42.221.41). Its IP number is 185.42.221.40 | |
| IP: | 185.42.221.40 |
| Server type: | Apache |
| Charset: | UTF-8 |
| PING www.exclusivelondonmodels.net (185.42.221.40) The package size is 26 bytes. | |
|---|---|
| 26 bytes for 185.42.221.40: seq_num=1 TTL=63 | 38.9 ms |
| 26 bytes for 185.42.221.40: seq_num=2 TTL=63 | 38.8 ms |
| 26 bytes for 185.42.221.40: seq_num=3 TTL=63 | 38.6 ms |
| --- www.exclusivelondonmodels.net ping results --- | |
| 4 queries proceeded, 4 packets received, 0 lost (0% loss) | |
| An average ping to the server is 29.1 ms, and the page load time is 0.73 seconds. | |
| Web Server Configuration | |
|---|---|
| Content Length: | 0 |
| Content Type: | text/html; charset=UTF-8 |
| Date: | Mon, 27 Mar 2017 11:31:01 GMT |
| Link: | ; rel="https://api.w.org/", ; rel=shortlink |
| Web Server: | Apache |
| P3P: | - |
| Cookies: | - |
| Vary: | - |
| ETag: | - |
| MD5 Content: | - |
| Public Key Pins: | - |
The data is estimated*
Data modified: 28.09.2017 20:54:24