www.fantasylondongirls.co.uk - Cheap London escorts for outcalls in South East England and London just £90. Call 07984111838 - Fantasylondongirls

fantasylondongirls.co.uk

visit the website

Fantasylondongirls is #62,486 website in United Kingdom. "Cheap London escorts for outcalls in South East England and London just £90. Call 07984111838."

62,486

2,220,286

World Rank

Domain http://www.fantasylondongirls.co.uk
Daily visits 333
Daily pages views 1,640
Estimated value £3,804 *
Income per visitor £2.41
Incoming links 56
Keyphrases
-
Rank in Countries
62486 United Kingdom
7065430 India
7237396 Ireland
g+ twitter facebook

Web Traffic

Country Rank in Countries Visitors % Pageviews %
United KingdomUnited Kingdom 62486 78.85% 78.02%
IndiaIndia 7065430 1.25% 0.73%
IrelandIreland 7237396 0.95% 1.05%
United Kingdom, India, Ireland are the most popular countries.
Region Region Rank Visitors % Pageviews %
Statistics History 3 Months Average
World Rank 2,220,286 -149,425
Monthly Visitors 8,400 6.73%
Monthly Visitors Rank 77,589,205 -5,221,753
Monthly Pageviews 49,200 -2.8%
Monthly Pageviews Rank 77,589,205 +2,172,498
Pageviews Per Visitor 5.86 -

Context

Headlines for www.fantasylondongirls.co.uk

Related Websites

connexionweb.co.uk   orientalmassagelondon.co.uk   007escorts.co.uk   absolutelondonescorts.co.uk   agencybarracuda.co.uk   awakeningtantricenergyspamassage.com   blog4asianescorts.co.uk   blog4escorts.co.uk   bluecoutureclub.com   

Web Server

Data Center Information

AS62240 Clouvider Limited
London
England
United Kingdom
51.5085, -0.1257
Web server load time is 0.22 seconds.
Its nameservers are dns3.nic.uk (213.248.220.1), dns4.nic.uk (43.230.48.1), nsc.nic.uk (156.154.102.3), dns2.nic.uk (103.49.80.1), nsa.nic.uk (156.154.100.3), nsb.nic.uk (156.154.101.3), dns1.nic.uk (213.248.216.1), nsd.nic.uk (156.154.103.3). Its IP number is 185.42.221.40
IP: 185.42.221.40
Server type: Apache
Charset: UTF-8
PING www.fantasylondongirls.co.uk (185.42.221.40) The package size is 30 bytes.
30 bytes for 185.42.221.40: seq_num=1 TTL=79 23.1 ms
30 bytes for 185.42.221.40: seq_num=2 TTL=79 23.3 ms
30 bytes for 185.42.221.40: seq_num=3 TTL=79 23.1 ms
--- www.fantasylondongirls.co.uk ping results ---
4 queries proceeded, 4 packets received, 0 lost (0% loss)
An average ping to the server is 17.4 ms, and the page load time is 0.22 seconds.
Web Server Configuration
Accept Ranges: bytes
Cache Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Content Length: 0
Content Type: text/html; charset=UTF-8
Date: Tue, 28 Mar 2017 13:32:43 GMT
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Last Modified: Tue, 28 Mar 2017 12:08:42 GMT
Pragma: no-cache
Web Server: Apache
Cookies: +
Vary: +
P3P: -
ETag: -
MD5 Content: -
Public Key Pins: -

The data is estimated*
Data modified: 28.09.2017 20:54:24