fetishserviceslondon.com
visit the websiteFetishserviceslondon is #4,481,020 website in United Kingdom. "London's premier guide to all things fetish . We deal with the bdsm and domination escorts, Bds."
4,481,020
38,247,451
World Rank
| Domain | http://www.fetishserviceslondon.com |
| Daily visits | 10 |
| Daily pages views | 25 |
| Estimated value | £255 * |
| Income per visitor | £2.52 |
| Incoming links | 0 |
| Keyphrases |
|---|
| - |
| Rank in Countries |
|---|
Web Traffic
| Statistics History 3 Months Average | ||
|---|---|---|
| World Rank | 38,247,451 | -3,339,002
 |
| Monthly Visitors | 240 | 8.73%
|
| Monthly Visitors Rank | 18,764,913 | -1,638,177
|
| Monthly Pageviews | 750 | -5.84%
 |
| Monthly Pageviews Rank | 18,764,913 |
+1,095,871
|
| Pageviews Per Visitor | 3.24 | - |
Context
| Headlines for www.fetishserviceslondon.com | |
|---|---|
| The domain has been registered 8 years 8 months 22 days ago. | |
Related Websites
connexionweb.co.uk orientalmassagelondon.co.uk 007escorts.co.uk absolutelondonescorts.co.uk agencybarracuda.co.uk awakeningtantricenergyspamassage.com blog4asianescorts.co.uk blog4escorts.co.uk bluecoutureclub.comWeb Server
| Data Center Information | |
|---|---|
|
AS62240 Clouvider Limited London England United Kingdom 51.5085, -0.1257 |
|
| Web server load time is 0.64 seconds. | |
| Its nameservers are ns1.lucid.dnsonly.co.uk (185.42.221.40), ns2.lucid.dnsonly.co.uk (185.42.221.41). Its IP number is 185.42.221.40 | |
| IP: | 185.42.221.40 |
| Server type: | Apache |
| Charset: | ISO-8859-1 |
| PING www.fetishserviceslondon.com (185.42.221.40) The package size is 45 bytes. | |
|---|---|
| 45 bytes for 185.42.221.40: seq_num=1 TTL=59 | 25.9 ms |
| 45 bytes for 185.42.221.40: seq_num=2 TTL=59 | 24.8 ms |
| 45 bytes for 185.42.221.40: seq_num=3 TTL=59 | 26.3 ms |
| --- www.fetishserviceslondon.com ping results --- | |
| 4 queries proceeded, 4 packets received, 0 lost (0% loss) | |
| An average ping to the server is 19.3 ms, and the page load time is 0.64 seconds. | |
| Web Server Configuration | |
|---|---|
| Content Length: | 241 |
| Content Type: | text/html; charset=iso-8859-1 |
| Date: | Tue, 28 Mar 2017 10:10:03 GMT |
| Web Server: | Apache |
| P3P: | - |
| Cookies: | - |
| Vary: | - |
| ETag: | - |
| MD5 Content: | - |
| Public Key Pins: | - |
The data is estimated*
Data modified: 28.09.2017 20:54:24