www.london69.co.uk - London asian escorts agency with sexy female asian escorts in London and exotic TS London escorts. T - London69

london69.co.uk

visit the website

London69 is #167,830 website in United Kingdom. "London asian escorts agency with sexy female asian escorts in London and exotic TS London escorts. T."

167,830

6,002,788

World Rank

Domain http://www.london69.co.uk
Daily visits 66
Daily pages views 190
Estimated value £618 *
Income per visitor £2.61
Incoming links 39
Keyphrases
-
Rank in Countries
g+ twitter facebook

Web Traffic

Statistics History 3 Months Average
World Rank 6,002,788 -14,407
Monthly Visitors 1,530 0.24%
Monthly Visitors Rank 98,595,301 -236,629
Monthly Pageviews 5,700 1%
Monthly Pageviews Rank 98,595,301 -985,953
Pageviews Per Visitor 3.73 -

Context

Headlines for www.london69.co.uk

Related Websites

connexionweb.co.uk   orientalmassagelondon.co.uk   007escorts.co.uk   absolutelondonescorts.co.uk   agencybarracuda.co.uk   awakeningtantricenergyspamassage.com   blog4asianescorts.co.uk   blog4escorts.co.uk   bluecoutureclub.com   

Web Server

Data Center Information

AS62240 Clouvider Limited
London
England
United Kingdom
51.5085, -0.1257
Web server load time is 1.44 seconds.
Its nameservers are nsc.nic.uk (156.154.102.3), dns3.nic.uk (213.248.220.1), nsa.nic.uk (156.154.100.3), dns1.nic.uk (213.248.216.1), dns2.nic.uk (103.49.80.1), nsd.nic.uk (156.154.103.3), dns4.nic.uk (43.230.48.1), nsb.nic.uk (156.154.101.3). Its IP number is 185.42.221.40
IP: 185.42.221.40
Server type: Apache
Charset: UTF-8
PING www.london69.co.uk (185.42.221.40) The package size is 45 bytes.
45 bytes for 185.42.221.40: seq_num=1 TTL=66 36.1 ms
45 bytes for 185.42.221.40: seq_num=2 TTL=66 35.4 ms
45 bytes for 185.42.221.40: seq_num=3 TTL=66 36.5 ms
--- www.london69.co.uk ping results ---
4 queries proceeded, 4 packets received, 0 lost (0% loss)
An average ping to the server is 27 ms, and the page load time is 1.44 seconds.
Web Server Configuration
Cache Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Content Type: text/html; charset=UTF-8
Date: Thu, 30 Mar 2017 00:34:45 GMT
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Link: ; rel="https://api.w.org/", ; rel=shortlink
Pragma: no-cache
Web Server: Apache
Cookies: +
P3P: -
Vary: -
ETag: -
MD5 Content: -
Public Key Pins: -

The data is estimated*
Data modified: 28.09.2017 20:54:24