www.pampertantric.com - Welcome to Pamper Tantric, the ultimate Tantra Massage London Agency! Join us for the most intense T - Pampertantric

pampertantric.com

visit the website

Pampertantric is #307,181 website in United Kingdom. "Welcome to Pamper Tantric, the ultimate Tantra Massage London Agency! Join us for the most intense T."

307,181

10,762,017

World Rank

Domain http://www.pampertantric.com
Daily visits 35
Daily pages views 141
Estimated value £510 *
Income per visitor £2.47
Incoming links 1,223
Keyphrases
tantric, tantra, massage, london
Rank in Countries
g+ twitter facebook

Web Traffic

Statistics History 3 Months Average
World Rank 10,762,017 -714,598
Monthly Visitors 870 6.64%
Monthly Visitors Rank 108,328,929 -7,193,041
Monthly Pageviews 4,230 0%
Monthly Pageviews Rank 108,328,929 -0
Pageviews Per Visitor 4.88 -

Context

Headlines for www.pampertantric.com
The domain has been registered 8 years 0 months 10 days ago.

Related Websites

connexionweb.co.uk   orientalmassagelondon.co.uk   007escorts.co.uk   absolutelondonescorts.co.uk   agencybarracuda.co.uk   awakeningtantricenergyspamassage.com   blog4asianescorts.co.uk   blog4escorts.co.uk   bluecoutureclub.com   

Web Server

Data Center Information

AS62240 Clouvider Limited
London
England
United Kingdom
51.5085, -0.1257
Web server load time is 0.28 seconds.
Its nameservers are ns1.lucid.dnsonly.co.uk (185.42.221.40), ns2.lucid.dnsonly.co.uk (185.42.221.41). Its IP number is 185.42.221.40
IP: 185.42.221.40
Server type: Apache
Charset: UTF-8
PING www.pampertantric.com (185.42.221.40) The package size is 41 bytes.
41 bytes for 185.42.221.40: seq_num=1 TTL=57 23.7 ms
41 bytes for 185.42.221.40: seq_num=2 TTL=57 23.3 ms
41 bytes for 185.42.221.40: seq_num=3 TTL=57 23.6 ms
--- www.pampertantric.com ping results ---
4 queries proceeded, 4 packets received, 0 lost (0% loss)
An average ping to the server is 17.7 ms, and the page load time is 0.28 seconds.
Web Server Configuration
Cache Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Content Type: text/html; charset=utf-8
Date: Fri, 31 Mar 2017 07:29:15 GMT
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Pragma: no-cache
Web Server: Apache
Cookies: +
P3P: -
Vary: -
ETag: -
MD5 Content: -
Public Key Pins: -

The data is estimated*
Data modified: 28.09.2017 20:54:24