punterplanet.co.uk
visit the websitePunterplanet is #1,389,862 website in United Kingdom. "Find the escort of your dreams."
1,389,862
19,719,082
World Rank
Domain | http://www.punterplanet.co.uk |
Daily visits | 19 |
Daily pages views | 76 |
Estimated value | £367 * |
Income per visitor | £2.51 |
Incoming links | 0 |
Keyphrases |
---|
- |
Rank in Countries |
---|
Web Traffic
Statistics History 3 Months Average | ||
---|---|---|
World Rank | 19,719,082 | -1,723,448 |
Monthly Visitors | 480 | 8.74% |
Monthly Visitors Rank | 45,881,530 | -4,010,046 |
Monthly Pageviews | 2,280 | 9.76% |
Monthly Pageviews Rank | 45,881,530 | -4,478,037 |
Pageviews Per Visitor | 4.77 | - |
Context
Headlines for www.punterplanet.co.uk | |
---|---|
Related Websites
connexionweb.co.uk orientalmassagelondon.co.uk 007escorts.co.uk absolutelondonescorts.co.uk agencybarracuda.co.uk awakeningtantricenergyspamassage.com blog4asianescorts.co.uk blog4escorts.co.uk bluecoutureclub.comWeb Server
Data Center Information | |
---|---|
AS62240 Clouvider Limited London England United Kingdom 51.5085, -0.1257 |
|
Web server load time is 0.41 seconds. |
Its nameservers are nsa.nic.uk (156.154.100.3), nsc.nic.uk (156.154.102.3), dns1.nic.uk (213.248.216.1), dns2.nic.uk (103.49.80.1), nsd.nic.uk (156.154.103.3), nsb.nic.uk (156.154.101.3), dns3.nic.uk (213.248.220.1), dns4.nic.uk (43.230.48.1). Its IP number is 185.42.221.40 | |
IP: | 185.42.221.40 |
Server type: | Apache |
Charset: | UTF-8 |
PING www.punterplanet.co.uk (185.42.221.40) The package size is 31 bytes. | |
---|---|
31 bytes for 185.42.221.40: seq_num=1 TTL=63 | 22.0 ms |
31 bytes for 185.42.221.40: seq_num=2 TTL=63 | 21.1 ms |
31 bytes for 185.42.221.40: seq_num=3 TTL=63 | 21.3 ms |
--- www.punterplanet.co.uk ping results --- | |
4 queries proceeded, 4 packets received, 0 lost (0% loss) | |
An average ping to the server is 16.1 ms, and the page load time is 0.41 seconds. |
Web Server Configuration | |
---|---|
Cache Control: | no-store, no-cache, must-revalidate, post-check=0, pre-check=0 |
Content Type: | text/html; charset=UTF-8 |
Date: | Fri, 31 Mar 2017 15:00:28 GMT |
Expires: | Thu, 19 Nov 1981 08:52:00 GMT |
Pragma: | no-cache |
Web Server: | Apache |
Cookies: | + |
P3P: | - |
Vary: | - |
ETag: | - |
MD5 Content: | - |
Public Key Pins: | - |
The data is estimated*
Data modified: 28.09.2017 20:54:24