www.ballyeaston.org - We are a friendly, welcoming and imaginative congregation open to everyone of every age. In our 2 - Ballyeaston

ballyeaston.org

visit the website

Ballyeaston is #858,758 website in United Kingdom. "We are a friendly, welcoming and imaginative congregation open to everyone of every age. In our 2."

858,758

16,727,806

World Rank

Domain http://www.ballyeaston.org
Daily visits 21
Daily pages views 94
Estimated value £407 *
Income per visitor £2.38
Incoming links 1
Keyphrases
second, ballyeaston, presbyterian, church, ballyclare, ballynure, worship, first, boys brigade
Rank in Countries
g+ twitter facebook

Web Traffic

Statistics History 3 Months Average
World Rank 16,727,806 -53,529
Monthly Visitors 540 0.32%
Monthly Visitors Rank 81,557,049 -260,983
Monthly Pageviews 2,820 1%
Monthly Pageviews Rank 81,557,049 -815,570
Pageviews Per Visitor 5.24 -

Context

Headlines for www.ballyeaston.org
The domain has been registered 17 years 11 months 20 days ago.

Related Websites

bowlingbasin.com   chwbbelfast.org   cointimeltd.com   erictherails.co.uk   kingswayfamilydentalpractice.com   mikemaldonado.com   nitransplant.org   rvtarantino.co.uk   shankillbankdentalpractice.com   

Web Server

Data Center Information
RapidSwitch Ltd
AS20860 Iomart
Glasgow
Scotland
United Kingdom
55.8652, -4.2576
Web server load time is 0.19 seconds.
Its nameservers are ns1152.bwfdns.com (5.133.180.141), ns1153.bwfdns.com (5.133.180.141). Its IP number is 5.133.180.141
IP: 5.133.180.141
Server type: Apache
Charset: UTF-8
PING www.ballyeaston.org (5.133.180.141) The package size is 47 bytes.
47 bytes for 5.133.180.141: seq_num=1 TTL=70 23.1 ms
47 bytes for 5.133.180.141: seq_num=2 TTL=70 22.1 ms
47 bytes for 5.133.180.141: seq_num=3 TTL=70 23.0 ms
--- www.ballyeaston.org ping results ---
4 queries proceeded, 4 packets received, 0 lost (0% loss)
An average ping to the server is 17.1 ms, and the page load time is 0.19 seconds.
Web Server Configuration
Accept Ranges: bytes
Content Length: 13315
Content Type: text/html
Date: Thu, 23 Mar 2017 01:16:18 GMT
Last Modified: Sat, 18 Mar 2017 20:00:57 GMT
Web Server: Apache
P3P: -
Cookies: -
Vary: -
ETag: -
MD5 Content: -
Public Key Pins: -

The data is estimated*
Data modified: 28.09.2017 20:54:24