www.bowlingbasin.com - Breathing new life into a special place at the gateway of the Forth Clyde Canal, Let the journ - Bowlingbasin

bowlingbasin.com

visit the website

Bowlingbasin is #4,942,784 website in United Kingdom. "Breathing new life into a special place at the gateway of the Forth Clyde Canal, Let the journ."

4,942,784

42,237,897

World Rank

Domain http://www.bowlingbasin.com
Daily visits 9
Daily pages views 32
Estimated value £270 *
Income per visitor £2.47
Incoming links 5
Keyphrases
-
Rank in Countries
g+ twitter facebook

Web Traffic

Statistics History 3 Months Average
World Rank 42,237,897 +2,335,756
Monthly Visitors 210 -5.53%
Monthly Visitors Rank 36,599,195 +2,023,935
Monthly Pageviews 960 -3%
Monthly Pageviews Rank 36,599,195 +1,097,976
Pageviews Per Visitor 4.61 -

Context

Headlines for www.bowlingbasin.com
The domain has been registered 10 years 9 months 3 days ago.

Related Websites

ballyeaston.org   chwbbelfast.org   cointimeltd.com   erictherails.co.uk   kingswayfamilydentalpractice.com   mikemaldonado.com   nitransplant.org   rvtarantino.co.uk   shankillbankdentalpractice.com   

Web Server

Data Center Information
RapidSwitch Ltd
AS20860 Iomart
Glasgow
Scotland
United Kingdom
55.8652, -4.2576
Web server load time is 0.53 seconds.
Its nameservers are ns1152.bwfdns.com (5.133.180.141), ns1153.bwfdns.com (5.133.180.141). Its IP number is 5.133.180.141
IP: 5.133.180.141
Server type: Apache
Charset: UTF-8
PING www.bowlingbasin.com (5.133.180.141) The package size is 30 bytes.
30 bytes for 5.133.180.141: seq_num=1 TTL=65 36.3 ms
30 bytes for 5.133.180.141: seq_num=2 TTL=65 37.2 ms
30 bytes for 5.133.180.141: seq_num=3 TTL=65 36.1 ms
--- www.bowlingbasin.com ping results ---
4 queries proceeded, 4 packets received, 0 lost (0% loss)
An average ping to the server is 27.4 ms, and the page load time is 0.53 seconds.
Web Server Configuration
Content Length: 0
Content Type: text/html; charset=UTF-8
Date: Thu, 23 Mar 2017 01:58:02 GMT
Link: ; rel=shortlink
Web Server: Apache
Vary: +
P3P: -
Cookies: -
ETag: -
MD5 Content: -
Public Key Pins: -

The data is estimated*
Data modified: 28.09.2017 20:57:45