mikemaldonado.com
visit the websiteMikemaldonado is #2,752,484 website in United Kingdom. "The Art of shirt making from A to Z. Step by step lessons on shirtmaking. All video tutorials."
2,752,484
27,381,573
World Rank
| Domain | http://www.mikemaldonado.com |
| Daily visits | 13 |
| Daily pages views | 55 |
| Estimated value | £321 * |
| Income per visitor | £2.34 |
| Incoming links | 3 |
| Keyphrases |
|---|
| shirt training, shirtmaking course, shirt making schools, making shirts, sewing, sewing videos, online sewing courses, learn to sew |
| Rank in Countries |
|---|
Web Traffic
| Statistics History 3 Months Average | ||
|---|---|---|
| World Rank | 27,381,573 | -167,028
 |
| Monthly Visitors | 330 | 0.61%
|
| Monthly Visitors Rank | 53,504,332 | -326,376
|
| Monthly Pageviews | 1,650 | -2%
 |
| Monthly Pageviews Rank | 53,504,332 |
+1,070,087
|
| Pageviews Per Visitor | 5.04 | - |
Context
| Headlines for www.mikemaldonado.com | |
|---|---|
| The domain has been registered 17 years 0 months 12 days ago. | |
Related Websites
ballyeaston.org bowlingbasin.com chwbbelfast.org cointimeltd.com erictherails.co.uk kingswayfamilydentalpractice.com nitransplant.org rvtarantino.co.uk shankillbankdentalpractice.comWeb Server
| Data Center Information | |
|---|---|
|
RapidSwitch Ltd AS20860 Iomart Glasgow Scotland United Kingdom 55.8652, -4.2576 |
|
| Web server load time is 0.17 seconds. | |
| Its nameservers are ns1152.bwfdns.com (5.133.180.141), ns1153.bwfdns.com (5.133.180.141). Its IP number is 5.133.180.141 | |
| IP: | 5.133.180.141 |
| Server type: | Apache |
| Charset: | ISO-8859-1 |
| PING www.mikemaldonado.com (5.133.180.141) The package size is 51 bytes. | |
|---|---|
| 51 bytes for 5.133.180.141: seq_num=1 TTL=68 | 48.7 ms |
| 51 bytes for 5.133.180.141: seq_num=2 TTL=68 | 47.1 ms |
| 51 bytes for 5.133.180.141: seq_num=3 TTL=68 | 48.3 ms |
| --- www.mikemaldonado.com ping results --- | |
| 4 queries proceeded, 4 packets received, 0 lost (0% loss) | |
| An average ping to the server is 36 ms, and the page load time is 0.17 seconds. | |
| Web Server Configuration | |
|---|---|
| Accept Ranges: | bytes |
| Content Length: | 2469 |
| Content Type: | text/html |
| Date: | Fri, 24 Mar 2017 05:27:12 GMT |
| Last Modified: | Wed, 08 Feb 2017 16:38:35 GMT |
| Web Server: | Apache |
| P3P: | - |
| Cookies: | - |
| Vary: | - |
| ETag: | - |
| MD5 Content: | - |
| Public Key Pins: | - |
The data is estimated*
Data modified: 28.09.2017 20:54:24