watersideboysbrigade.org
visit the websiteWatersideboysbrigade is #1,560,819 website in United Kingdom. "Waterside Boys Brigade Home."
1,560,819
20,684,234
World Rank
| Domain | http://www.watersideboysbrigade.org |
| Daily visits | 18 |
| Daily pages views | 76 |
| Estimated value | £367 * |
| Income per visitor | £2.46 |
| Incoming links | 1 |
| Keyphrases |
|---|
| - |
| Rank in Countries |
|---|
Web Traffic
| Statistics History 3 Months Average | ||
|---|---|---|
| World Rank | 20,684,234 | +769,454
 |
| Monthly Visitors | 450 | -3.72%
|
| Monthly Visitors Rank | 11,513,476 | +428,301
|
| Monthly Pageviews | 2,280 | 2%
 |
| Monthly Pageviews Rank | 24,194,859 |
-483,897
|
| Pageviews Per Visitor | 5.07 | - |
Context
| Headlines for www.watersideboysbrigade.org | |
|---|---|
| The domain has been registered 13 years 2 months 25 days ago. | |
Related Websites
ballyeaston.org bowlingbasin.com chwbbelfast.org cointimeltd.com erictherails.co.uk kingswayfamilydentalpractice.com mikemaldonado.com nitransplant.org rvtarantino.co.ukWeb Server
| Data Center Information | |
|---|---|
|
RapidSwitch Ltd AS20860 Iomart Glasgow Scotland United Kingdom 55.8652, -4.2576 |
|
| Web server load time is 0.00 seconds. | |
| Its nameservers are ns1152.bwfdns.com (5.133.180.141), ns1153.bwfdns.com (5.133.180.141). Its IP number is 5.133.180.141 | |
| IP: | 5.133.180.141 |
| Server type: | |
| Charset: | UTF-8 |
| PING www.watersideboysbrigade.org (5.133.180.141) The package size is 42 bytes. | |
|---|---|
| 42 bytes for 5.133.180.141: seq_num=1 TTL=70 | 25.0 ms |
| 42 bytes for 5.133.180.141: seq_num=2 TTL=70 | 25.5 ms |
| 42 bytes for 5.133.180.141: seq_num=3 TTL=70 | 24.8 ms |
| --- www.watersideboysbrigade.org ping results --- | |
| 4 queries proceeded, 4 packets received, 0 lost (0% loss) | |
| An average ping to the server is 18.8 ms, and the page load time is 0.00 seconds. | |
| Web Server Configuration |
|---|
The data is estimated*
Data modified: 28.09.2017 20:54:24